General Information

  • ID:  hor001520
  • Uniprot ID:  Q7YX32
  • Protein name:  GQTFVRF-amide
  • Gene name:  flp-16
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Each flp gene is expressed in a distinct set of neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045988 negative regulation of striated muscle contraction; GO:0071244 cellular response to carbon dioxide; GO:1903745 negative regulation of nematode pharyngeal pumping
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GQTFVRF
  • Length:  7(78-84)
  • Propeptide:  MNFSGFEFSSIVAFFLLILQLSTAAVLPADYAYGVADEMSALPDSGSLFAEQRPSKRAQTFVRFGKRAQTFVRFGKRGQTFVRFGRSAPFEQ
  • Signal peptide:  MNFSGFEFSSIVAFFLLILQLSTA
  • Modification:  T7 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamides and FMRFamide-like peptides are neuropeptides. AQTFVRF-amide inhibits the activity of dissected pharyngeal myogenic muscle system.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7YX32-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001520_AF2.pdbhor001520_ESM.pdb

Physical Information

Mass: 96117 Formula: C40H59N11O10
Absent amino acids: ACDEHIKLMNPSWY Common amino acids: F
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: 10 Boman Index: -1209
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 41.43
Instability Index: 2620 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16061202
  • Title:  Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry